PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09055
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MIKC_MADS
Protein Properties Length: 293aa    MW: 33002.2 Da    PI: 6.155
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09055genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.26.8e-314595151
              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
              krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs +g+lyeys+
  EMT09055 45 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSGRGRLYEYSN 95
              79***********************************************95 PP

2K-box20.71.8e-0820223369100
     K-box  69 KnellleqieelqkkekelqeenkaLrkklee 100
               +nell+++ie++q++e elq++n  L++k++e
  EMT09055 202 QNELLCAEIEYMQRREMELQNNNFFLKEKVAE 233
               89***************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.1E-413796IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.5433797IPR002100Transcription factor, MADS-box
CDDcd002656.70E-393898No hitNo description
SuperFamilySSF554551.03E-2938117IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003993IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-323959IPR002100Transcription factor, MADS-box
PfamPF003192.6E-264693IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-325974IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-327495IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MQILNEQLAA PSTGLMVKES ASPGSGSGSA GGAAEKMGRG RIEIKRIENT TNRQVTFCKR  60
RNGLLKKAYE LSVLCDAEVA LIVFSGRGRL YEYSNNSNSV TAAYKIICVY VSHTQIDVKA  120
ILRTEPMAVT ARNEEFSSLM FDSGTLVVCV KATIERYKKA TSDISSAGTV AEINAQHYQQ  180
EEAADNHLAE LQQFLTFTIN LQNELLCAEI EYMQRREMEL QNNNFFLKEK VAETERGQQQ  240
TLNMMGAAST SNEYEQNMIH CDPRTFLQFN FMQQQPQYYS QQEDRKSFNS VGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-1837104169Myocyte-specific enhancer factor 2B
1tqe_Q1e-1837104169Myocyte-specific enhancer factor 2B
1tqe_R1e-1837104169Myocyte-specific enhancer factor 2B
1tqe_S1e-1837104169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028631e-161AM502863.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM2 (WM2 gene).
GenBankBT0089121e-161BT008912.1 Triticum aestivum clone wpa1c.pk001.p9:fis, full insert mRNA sequence.
GenBankJN8743861e-161JN874386.1 Triticum aestivum cultivar A3017 MADS-box transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288321.11e-109MADS-box transcription factor 58-like
SwissprotQ2V0P12e-94MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLM8B6080.0M8B608_AEGTA; MADS-box transcription factor 58
STRINGMLOC_57700.11e-128(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-57MIKC_MADS family protein